Anti-ATP6V1C2 antibody (ab176771)
Key features and details
- Rabbit polyclonal to ATP6V1C2
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-ATP6V1C2 antibody -
Description
Rabbit polyclonal to ATP6V1C2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Human ATP6V1C2 aa 2-195. (BC012142).
Sequence:SEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLV GLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFV THFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLEN LEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQ
Database link: Q8NEY4-2 -
Positive control
- Human fetal kidney and mouse kidney lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200ul Sterile Distilled Water. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Images
-
All lanes : Anti-ATP6V1C2 antibody (ab176771) at 1/500 dilution
Lane 1 : Human fetal kidney lysate
Lane 2 : Mouse kidney lysate
Predicted band size: 44, 49 kDa
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-ATP6V1C2 antibody (ab176771)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal heart tissue labeling ATP6V1C2 with ab176771 at 1/100 dilution.